
Merck Anti-PRKG2 antibody produced in rabbit
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PRKG2 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-Type II cGMP-dependent protein kinase antibody produced in rabbit, Anti-cGKII antibody produced in rabbit, Anti-CGK 2 antibody produced in rabbit, Anti-cGMP-dependent protein kinase 2 antibody produced in rabbit
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunohistochemistry: 1:20- 1:50
면역원 서열
REYHLKELREQLSKQTVAIAELTEELQNKCIQLNKLQDVVHMQGGSPLQASPDKVPLEVHRKTSGLVSLHSRRGAKAGVSAEPTTRTYDLNKPPEFSFEKARVRKDSSEKKLITDALNKNQFLKRLDPQQIKDMVE
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... PRKG2(5593)
PRKG2 is also known as cGK II (Type II cGMP-dependent protein kinase) that contains an N-terminal regulatory domain, two cGMP-binding domains and a C-terminal catalytic domain. The N-terminal domain contains a dimerization and an autoinhibitory region. It is found to be bound to the membrane by a myristoyl moiety. It is mainly expressed in intestine, brain, and kidney. The gene is localized to human chromosome 4 and contains 19 exons spanning a length of 125kb.
🏷️Merck Sigma 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Merck Sigma
Merck Anti-PRDM2 antibody produced in rabbit
370,530원

Merck Sigma
Merck Anti-PPP2R5E antibody produced in rabbit
370,530원

Merck Sigma
Merck Anti-PRKG2 antibody produced in rabbit
895,700원

Merck Sigma
Merck Anti-POF1B antibody produced in rabbit
370,530원

Merck Sigma
Merck Anti-PPFIBP2 antibody produced in rabbit
895,700원
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|