상품 옵션 정보 | ||||||||
---|---|---|---|---|---|---|---|---|
카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
HPA006367-100UL | - | Merck HPA006367-100UL Anti-PCYT1B antibody produced in rabbit, 100uL pk | 재고문의 | pk | 951,160원 | - | 1,046,276원 |
Anti-PCYT1B antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-CCT B antibody produced in rabbit, Anti-CT B antibody produced in rabbit, Anti-CCT-β antibody produced in rabbit, Anti-CTP:phosphocholine cytidylyltransferase B antibody produced in rabbit, Anti-Choline-phosphate cytidylyltransferase B antibody produced in rabbit, Anti-Phosphorylcholine transferase B antibody produced in rabbit
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunohistochemistry: 1:20- 1:50
면역원 서열
PVVTTDAESETGIPKSLSNEPPSETMEEIEHTCPQPRLTLTAPAPFADETNCQCQAPHEKLTIAQARLGTPADRPVRVYADGIFDLFHSGHARALMQAKTLFPNSYLLVGV
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... PCYT1B(9468)
PCYT1B (phosphate cytidylyltransferase 1, choline β), is the second isoform of the enzyme CTP:phosphocholine cytidylyltransferase (CCT). The other isoform of this enzyme is CCTα. PCYT1B transcripts are present in both human adult and fetal tissues. It has a predominant expression in testis and placenta. Its catalytic domain is highly similar to that of CCTα, which is succeeded by three amphipathic helical repeats. This protein is localized to the cytosol.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|