
Merck Anti-NRG4 antibody produced in rabbit
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-NRG4 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-Pro-neuregulin-4, membrane-bound isoform antibody produced in rabbit, Anti-Pro-NRG4 antibody produced in rabbit
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunohistochemistry: 1:20- 1:50
면역원 서열
MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTK
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... NRG4(145957)
NRG4 (neuregulin 4) belongs to a family of epidermal growth factors (EGFs), which in human has four members, from NRG1- NRG4. It is a transmembrane protein containing 115 amino acids, and has an EGF domain. The EGF domain is located at the N-terminal, which also contains one N-linked glycosylation site. This protein contains another isoform called NRG4A2, which contains a putative type I PDZ-binding peptide, in the C-terminal. NRG4 has limited expression in adult tissues and is not expressed in brain. Both the isoforms of NRG4, NRG4A1 and NRG4A2, are expressed on the surface of the cell, where NRG4A2 is found in punctate membrane regions and NRG4A1 resides at membrane ruffles.
🏷️Merck Sigma 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Merck Sigma
Merck Anti-CT83 antibody produced in rabbit
370,530원

Merck Sigma
Merck Anti-OAZ1 antibody produced in rabbit
370,530원

Merck Sigma
Merck Anti-NRG4 antibody produced in rabbit
370,530원

Merck Sigma
Merck Anti-NXF2B antibody produced in rabbit
895,600원

Merck Sigma
Merck Anti-NR2C2 antibody produced in rabbit
370,530원
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|