Anti-NRG4 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-Pro-neuregulin-4, membrane-bound isoform antibody produced in rabbit, Anti-Pro-NRG4 antibody produced in rabbit
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunohistochemistry: 1:20- 1:50
면역원 서열
MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTK
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... NRG4(145957)
NRG4 (neuregulin 4) belongs to a family of epidermal growth factors (EGFs), which in human has four members, from NRG1- NRG4. It is a transmembrane protein containing 115 amino acids, and has an EGF domain. The EGF domain is located at the N-terminal, which also contains one N-linked glycosylation site. This protein contains another isoform called NRG4A2, which contains a putative type I PDZ-binding peptide, in the C-terminal. NRG4 has limited expression in adult tissues and is not expressed in brain. Both the isoforms of NRG4, NRG4A1 and NRG4A2, are expressed on the surface of the cell, where NRG4A2 is found in punctate membrane regions and NRG4A1 resides at membrane ruffles.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|