
Merck Anti-NFKBIE antibody produced in rabbit
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-NFKBIE antibody produced in rabbit
Ab1, Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-I-κ-B-ε antibody produced in rabbit, Anti-NF-κ-BIE antibody produced in rabbit, Anti-NF-κ-B inhibitor ε antibody produced in rabbit, Anti-IKBE antibody produced in rabbit, Anti-IKB-ε antibody produced in rabbit, Anti-IκBε antibody produced in rabbit
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunohistochemistry: 1:50- 1:200
면역원 서열
PEPGRGTSHSLDLQLQNWQGLACLHIATLQKNQPLMELLLRNGADIDVQEGTSGKTALHLAVETQERGLVQFLLQAGAQVDARMLNGCTPLHLAAGRGLMGISSTLCKAGADSLLRNVEDETPQDLTEESLVLLPFDDLKI
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... NFKBIE(4794)
NFKBIE (NFKB inhibitor ε) belongs to the novel IκB (nuclear factor of κ light polypeptide gene enhancer in B-cells inhibitor) family and is expressed in particular cell types such as the spleen, lung and testis at different level. It is mainly involved in the regulation of NF (nuclear factor)-κB-dependent transcription.
🏷️Merck Sigma 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Merck Sigma
Merck Anti-NGDN antibody produced in rabbit
370,530원

Merck Sigma
Merck Anti-NDFIP2 antibody produced in rabbit
370,530원

Merck Sigma
Merck Anti-NFKBIE antibody produced in rabbit
895,700원

Merck Sigma
Merck Anti-NDP antibody produced in rabbit
895,700원

Merck Sigma
Merck Anti-NCOR2 antibody produced in rabbit
370,530원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
