
Merck Anti-MYEF2 antibody produced in rabbit
Rabbit polyclonal anti-MYEF2 antibody for human targets. Suitable for immunoblotting, immunofluorescence, and immunohistochemistry. Affinity isolated, buffered aqueous glycerol solution. Member of Prestige Antibodies® Powered by Atlas Antibodies.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MYEF2 antibody produced in rabbit
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution.
Anti-Myelin expression factor 2 antibody produced in rabbit, also known as Anti-MyEF-2 or Anti-MST156.
생물학적 소스
rabbit
스펙 정보
| 항목 | 내용 |
|---|---|
| Quality Level | 100 |
| 결합 | unconjugated |
| 항체 형태 | affinity isolated antibody |
| antibody product type | primary antibodies |
| 클론 | polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 형태(form) | buffered aqueous glycerol solution |
| species reactivity | human |
| 포장 | antibody small pack of 25 μL |
| 배송 상태 | wet ice |
| 저장 온도 | −20°C |
| UniProt 수납 번호 | Q9P2K5 |
적용 기술
- Immunoblotting: 0.04–0.4 μg/mL
- Immunofluorescence: 0.25–2 μg/mL
- Immunohistochemistry: 1:200–1:500
면역원 서열
GMGSMNSVTGGMGMGLDRMSSSFDRMGPGIGAILERSIDMDRGFLSGPMGSGMRERIGSKGNQIFVRNLPFDLTWQKLKEKFSQCGHVMFAEIKMENGKSKGCGTVRFDSPESAEKACRIMNGIKISGREIDVRLDRN
Gene Information
human ... MYEF2(50804)
MYEF2 (myelin expression factor 2) is a member of the myocyte enhancer factor-2 (MEF2) family of MADS (MCM1, agamous, deficiens, serum response factor)-box transcription factors. It reflects a strong response to cell division, differentiation, and cell death in a calcium-dependent manner.
🏷️Merck Sigma 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Merck Sigma
Merck Anti-NEK9 antibody produced in rabbit
895,700원

Merck Sigma
Merck Anti-MYH6 antibody produced in rabbit
370,530원

Merck Sigma
Merck Anti-MYEF2 antibody produced in rabbit
370,530원

Merck Sigma
Merck Anti-MUC4 antibody produced in rabbit
370,530원

Merck Sigma
Merck Anti-NDUFB8 antibody produced in rabbit
895,700원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|