Merck Anti-MYEF2 antibody produced in rabbit
Rabbit polyclonal anti-MYEF2 antibody for human targets. Suitable for immunoblotting, immunofluorescence, and immunohistochemistry. Affinity isolated, buffered aqueous glycerol solution. Member of Prestige Antibodies® Powered by Atlas Antibodies.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-MYEF2 antibody produced in rabbit
Anti-MYEF2 antibody produced in rabbit
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution.
Anti-Myelin expression factor 2 antibody produced in rabbit, also known as Anti-MyEF-2 or Anti-MST156.
생물학적 소스
rabbit
스펙 정보
| 항목 | 내용 |
|---|---|
| Quality Level | 100 |
| 결합 | unconjugated |
| 항체 형태 | affinity isolated antibody |
| antibody product type | primary antibodies |
| 클론 | polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 형태(form) | buffered aqueous glycerol solution |
| species reactivity | human |
| 포장 | antibody small pack of 25 μL |
| 배송 상태 | wet ice |
| 저장 온도 | −20°C |
| UniProt 수납 번호 | Q9P2K5 |
적용 기술
- Immunoblotting: 0.04–0.4 μg/mL
- Immunofluorescence: 0.25–2 μg/mL
- Immunohistochemistry: 1:200–1:500
면역원 서열
GMGSMNSVTGGMGMGLDRMSSSFDRMGPGIGAILERSIDMDRGFLSGPMGSGMRERIGSKGNQIFVRNLPFDLTWQKLKEKFSQCGHVMFAEIKMENGKSKGCGTVRFDSPESAEKACRIMNGIKISGREIDVRLDRN
Gene Information
human ... MYEF2(50804)
MYEF2 (myelin expression factor 2) is a member of the myocyte enhancer factor-2 (MEF2) family of MADS (MCM1, agamous, deficiens, serum response factor)-box transcription factors. It reflects a strong response to cell division, differentiation, and cell death in a calcium-dependent manner.
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.