Merck ANTI-APPL1 antibody produced in rabbit
상품 옵션 정보 | |||||||||
---|---|---|---|---|---|---|---|---|---|
카탈로그 번호 | CAS 번호 | 설명 | 상태 | 재고 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
HPA011138-100UL | - | Merck HPA011138-100UL ANTI-APPL1 antibody produced in rabbit, 100uL pk | 재고문의 | 0 | pk | 817,800원 | - | 899,580원 |
다른 상품 둘러보기
ANTI-APPL1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-DCC-interacting protein 13-alpha, Anti-Dip13-alpha, Anti-APPL, Anti-Adapter protein containing PH domain, PTB domain and leucine zipper motif 1
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunohistochemistry: 1:500- 1:1000
면역원 서열
VTRLTFPLPCVVLYATHQENKRLFGFVLRTSSGRSESNLSSVCYIFESNNEGEKICDSVGLAKQIALHAELDRRASEKQKEIERVKEKQQKELNKQKQIEKDLEEQ
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... APPL1(26060)
APPL1 (adaptor protein, phosphotyrosine interaction, PH domain and leucine zipper containing 1) is an endosomal adaptor protein which is made of 709 amino acids. It has a PTB (phosphotyrosine binding) domain at its C-terminal, Bin-Amphiphysin-Rvs (BAR) domain at the N-terminal, and an intervening pleckstrin homology (PH) domain. This gene is localized to the human chromosomal region 3p14.3-p21.1. It is abundantly expressed in heart, pancreas, ovary and skeletal muscle.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|