CacheBy
Merck Anti-GNAI2 antibody produced in rabbit
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Merck Anti-GNAI2 antibody produced in rabbit

상품 한눈에 보기

Merck의 Anti-GNAI2 항체는 rabbit에서 생산된 polyclonal primary antibody로, human GNAI2 단백질을 인식합니다. Immunofluorescence 및 immunohistochemistry에 적합하며 Prestige Antibodies® 라인 제품입니다. −20°C에서 보관하며 wet ice 상태로 배송됩니다.

브랜드
Merck Sigma

Merck Sigma · Merck Anti-GNAI2 antibody produced in rabbit

Anti-GNAI2 antibody produced in rabbit

제품 개요

Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
Anti-Guanine nucleotide-binding protein G(i), alpha-2 subunit
Anti-Adenylate cyclase-inhibiting G alpha protein

생물학적 정보

항목 내용
Biological Source Rabbit
Quality Level 100
Conjugation Unconjugated
Antibody Form Affinity isolated antibody
Product Type Primary antibodies
Clone Polyclonal
Product Line Prestige Antibodies® Powered by Atlas Antibodies
Form Buffered aqueous glycerol solution
Species Reactivity Human
Packaging Antibody small pack of 25 μL
Techniques Immunofluorescence: 0.25–2 μg/mL
Immunohistochemistry: 1:20–1:50
Immunogen Sequence EEECRQYRAVVYSNTIQSIMAIVKAMGNLQIDFADPSRADDARQLFALSCTAEEQGVLPDDLSGVIRRLWADHGVQACFGRSREYQLNDSAAYYLNDLER
UniProt Accession P04899
Shipping Conditions Wet ice
Storage Temperature −20°C

유전자 정보

Gene: human GNAI2 (2771)
GNAI2 (guanine nucleotide binding protein (G protein), α inhibiting activity polypeptide 2) gene encodes an α subunit of guanine nucleotide binding proteins (G proteins).
It is a member of the G protein signal transduction family that includes Giα1 (GNAI1) and Giα3 (GNAI3).
This gene is localized to the short arm of human chromosome 3p21, aberrations in which are associated with several tumors.

제품 이미지

(이미지 없음)

Merck Sigma 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.