
Merck Anti-GNAI2 antibody produced in rabbit
Merck의 Anti-GNAI2 항체는 rabbit에서 생산된 polyclonal primary antibody로, human GNAI2 단백질을 인식합니다. Immunofluorescence 및 immunohistochemistry에 적합하며 Prestige Antibodies® 라인 제품입니다. −20°C에서 보관하며 wet ice 상태로 배송됩니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-GNAI2 antibody produced in rabbit
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
Anti-Guanine nucleotide-binding protein G(i), alpha-2 subunit
Anti-Adenylate cyclase-inhibiting G alpha protein
생물학적 정보
| 항목 | 내용 |
|---|---|
| Biological Source | Rabbit |
| Quality Level | 100 |
| Conjugation | Unconjugated |
| Antibody Form | Affinity isolated antibody |
| Product Type | Primary antibodies |
| Clone | Polyclonal |
| Product Line | Prestige Antibodies® Powered by Atlas Antibodies |
| Form | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| Packaging | Antibody small pack of 25 μL |
| Techniques | Immunofluorescence: 0.25–2 μg/mL Immunohistochemistry: 1:20–1:50 |
| Immunogen Sequence | EEECRQYRAVVYSNTIQSIMAIVKAMGNLQIDFADPSRADDARQLFALSCTAEEQGVLPDDLSGVIRRLWADHGVQACFGRSREYQLNDSAAYYLNDLER |
| UniProt Accession | P04899 |
| Shipping Conditions | Wet ice |
| Storage Temperature | −20°C |
유전자 정보
Gene: human GNAI2 (2771)
GNAI2 (guanine nucleotide binding protein (G protein), α inhibiting activity polypeptide 2) gene encodes an α subunit of guanine nucleotide binding proteins (G proteins).
It is a member of the G protein signal transduction family that includes Giα1 (GNAI1) and Giα3 (GNAI3).
This gene is localized to the short arm of human chromosome 3p21, aberrations in which are associated with several tumors.
제품 이미지
(이미지 없음)
🏷️Merck Sigma 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Merck Sigma
Merck Anti-GP1BA antibody produced in rabbit
817,800원

Merck Sigma
Merck Anti-PFKM antibody produced in rabbit
370,530원

Merck Sigma
Merck Anti-GNAI2 antibody produced in rabbit
370,530원

Merck Sigma
Merck Anti-USP7 antibody produced in rabbit
817,800원

Merck Sigma
Merck Anti-QRFPR antibody produced in rabbit
895,700원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|