Merck Anti-GNAI2 antibody produced in rabbit
다른 상품 둘러보기
Anti-GNAI2 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-Guanine nucleotide-binding protein G(i), alpha-2 subunit, Anti-Adenylate cyclase-inhibiting G alpha protein
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:20-1:50
면역원 서열
EEECRQYRAVVYSNTIQSIMAIVKAMGNLQIDFADPSRADDARQLFALSCTAEEQGVLPDDLSGVIRRLWADHGVQACFGRSREYQLNDSAAYYLNDLER
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... GNAI2(2771)
GNAI2 (guanine nucleotide binding protein (G protein), α inhibiting activity polypeptide 2) gene encodes an α subunit of guanine nucleotide binding proteins (G proteins). It is a member of the G protein signal transduction family that includes Giα1 (GNAI1) and Giα3 (GNAI3). This gene is localized to the short arm of human chromosome 3p21, aberrations in which are associated with several tumors.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|