
Merck Anti-GLIPR1 antibody produced in rabbit
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-GLIPR1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-RTVP-1 protein, Anti-Glioma pathogenesis-related protein 1 precursor, Anti-GliPR 1
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunohistochemistry: 1:20- 1:50
면역원 서열
NEDFIKDCVRIHNKFRSEVKPTASDMLYMTWDPALAQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGENIWTGSVPIFSVSSAITNWYDEIQDYDF
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... GLIPR1(11010)
Glioma pathogenesis-related protein 1 (GLIPR1) is a multifunctional protein which was first recognized in human glioblastomas. It resides in endoplasmic reticulum (ER) and vesicles in cytoplasm. It is a transmembrane protein with its C-terminal spanning the membrane, and has a signal peptide at its N-terminal. It belongs to the CAP (cysteine-rich secretory proteins, antigen 5 and pathogenesis-related 1 proteins) family of proteins, and thus, contains the cysteine-rich CAP domain. GLIPR1 exists as three isoforms, namely, GLIPR1, GLIPR1-like 1 (GLIPR1L1) and GLIPR1-like 2 (GLIPR1L2). GLIPR1 and GLIPR1L2 have a wide range of tissue expression, whereas GLIPR1L1 is predominantly expressed in testis.
🏷️Merck Sigma 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Merck Sigma
Merck Anti-MLLT6 antibody produced in rabbit
895,700원

Merck Sigma
Merck Anti-RPL35 antibody produced in rabbit
895,700원

Merck Sigma
Merck Anti-GLIPR1 antibody produced in rabbit
370,530원

Merck Sigma
Merck Anti-ANKK1 antibody produced in rabbit
895,700원

Merck Sigma
Merck Anti-SLK antibody produced in rabbit
895,700원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
