Anti-FCGRT antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-Neonatal Fc receptor, Anti-FcRn, Anti-IgG receptor FcRn large subunit p51 precursor, Anti-IgG Fc fragment receptor transporter alpha chain
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunohistochemistry: 1:500-1:1000
면역원 서열
LSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLK
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... FCGRT(2217)
FCGRT is an IgG binding protein that is similar to the α chain of class I major histocompatibility complex proteins. FCGRT may be found in tissues such as the placental cells, epithelial cells of intestines and in the endothelial cells of capillaries among many others. FCGRT regulates IgG transport in the placenta and also modulates IgG homeostasis . Anti-FCGRT antibody is specific for IgG receptor FcRn large subunit p51 in humans.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|