Merck Anti-KCNH7 antibody produced in rabbit
다른 상품 둘러보기
Anti-KCNH7 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-Potassium voltage-gated channel subfamily H member 7, Anti-Ether-a-go-go-related protein 3, Anti-Ether-a-go-go-related gene potassium channel 3, Anti-Eag-related protein 3, Anti-HERG-3, Anti-Voltage-gated potassium channel subunit Kv113
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunohistochemistry: 1:1000- 1:2500
면역원 서열
DNCKLRRRKLSFESEGEKENSTNDPEDSADTIRHYQSSKRHFEEKKSRSSSFISSIDDEQKPLFSGIVDSSPGIGKASGLDFEETVPTSGRMHIDKRSHSCKDITDMRSWERENAHPQPEDSSPSALQRAA
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... KCNH7(90134)
Potassium voltage-gated channel, Eag related subfamily H, member 7 (KCNH7) is part of the _ether-á-go-go_-related (ERG) family. It is expressed in those regions of the brain which are associated with mood and cognition. The gene encoding it is localized on chromosome 2.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.