Merck Anti-SLC39A5 antibody produced in rabbit
다른 상품 둘러보기
Anti-SLC39A5 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-Zinc transporter ZIP5 precursor, Anti-ZIP-5, Anti-Solute carrier family 39 member 5, Anti-Zrt- and Irt-like protein 5
생물학적 소스
rabbit
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
면역원 서열
ENGTLTAGGLARLLHSLGLGRVQGLRLGQHGPLTGRAASPAADNSTHRPQNPELSVDVWAGMPLGPSGWGDLEESKAPHLPRGPAPSGLDLLHRLLLLDHSLADHLNEDCLNGSQLLVNFGLSPAAPLTPR
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... SLC39A5(283375)
The gene solute carrier family 39 member 5 (SLC39A5) is mapped to human chromosome 12q13. It belongs to ZIP (ZRT, IRT-like protein) family of transporters. It is expressed in several tissues including intestine, pancreas, liver and kidney. Additionally, SLC39A5 is abundantly expressed in sclera and retina during eye development. It is localized in the Golgi membrane, membrane of endoplasmic reticulum and plasma membrane. The protein has eight predicted transmembrane domains.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|