Merck Anti-LRRC55 antibody produced in rabbit
다른 상품 둘러보기
Anti-LRRC55 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-Leucine-rich repeat-containing protein 55 precursor
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunohistochemistry: 1:20- 1:50
면역원 서열
RLAHLDLSYNNFSHVPADMFQEAHGLVHIDLSHNPWLRRVHPQAFQGLMQLRDLDLSYGGLAFLSLEALEGLPGLVTLQIGGNPWVCGCTMEPLLKWLRNRIQRCTADSQ
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... LRRC55(219527)
The gene LRRC55 (leucine rich repeat containing 55) encodes a LRRC26 paralogous protein that belongs to the γ family of the BK (voltage and calcium-activated potassium) channel auxiliary proteins. It is specifically expressed in the brain. The encoded protein has a molar mass of ∼35kDa and has an extracellular LRR domain comprising of repeating 20–29 residue leucine-rich sequence stretches. The domain has a consensus sequence of LxxLxLxxN, where x is any amino acid, capped by two cysteine-rich sequences of variable length on both ends. It has a single transmembrane topology.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|