Merck Anti-LRRC55 antibody produced in rabbit
토끼에서 생산된 Anti-LRRC55 항체로, 인간 LRRC55 단백질을 인식하는 polyclonal 1차 항체입니다. Prestige Antibodies® 라인 제품으로, 면역조직화학(IHC)에 적합하며, −20°C에서 보관합니다. 버퍼링된 글리세롤 수용액 형태로 제공됩니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-LRRC55 antibody produced in rabbit
Anti-LRRC55 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
Anti-Leucine-rich repeat-containing protein 55 precursor
제품 정보 요약
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| Quality Level | 100 |
| 결합 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| Antibody Product Type | Primary antibodies |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 형태(Form) | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| 포장 단위 | 25 μL (small pack) |
| 기술(Technique) | Immunohistochemistry (1:20–1:50) |
| 면역원 서열 | RLAHLDLSYNNFSHVPADMFQEAHGLVHIDLSHNPWLRRVHPQAFQGLMQLRDLDLSYGGLAFLSLEALEGLPGLVTLQIGGNPWVCGCTMEPLLKWLRNRIQRCTADSQ |
| UniProt 수납 번호 | Q6ZSA7 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20°C |
| Gene Information | Human LRRC55 (219527) |
Gene Information
The gene LRRC55 (leucine rich repeat containing 55) encodes a LRRC26 paralogous protein that belongs to the γ family of the BK (voltage and calcium-activated potassium) channel auxiliary proteins. It is specifically expressed in the brain. The encoded protein has a molar mass of approximately 35 kDa and contains an extracellular LRR domain with repeating 20–29 residue leucine-rich sequence stretches. The domain has a consensus sequence of LxxLxLxxN, capped by two cysteine-rich sequences of variable length on both ends, and has a single transmembrane topology.
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.