Anti-SCYL1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-Telomerase transcriptional element-interacting factor, Anti-SCY1-like protein 1, Anti-Teratoma-associated tyrosine kinase, Anti-Telomerase regulation-associated protein, Anti-N-terminal kinase-like protein
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunofluorescence: 0.25-2 μg/mL
면역원 서열
AFPEDFCRHKVLPQLLTAFEFGNAGAVVLTPLFKVGKFLSAEEYQQKIIPVVVKMFSSTDRAMRIRLLQQMEQFIQYLDEPTVNTQIFPHVVHGFLDTNPAIREQTVKSMLLLAPKLNEANLNVELMK
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... SCYL1(57410)
SCYL1 (SCY1-like, kinase-like 1) belongs to the catalytically non-functional protein kinase family called Scy1-like protein family. It has a RKXX-COO- motif present at its C-terminal. It has a protein kinase-like domain at its N-terminal domain, and this protein is evolutionarily conserved. It is also called TEIF (telomerase transcriptional elementsinteracting factor), acts as a transcription factor, and resides in centrosome. This gene is localized to human chromosome 11q13.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|