Merck Anti-IL1RL2 antibody produced in rabbit
다른 상품 둘러보기
Anti-IL1RL2 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-IL-1Rrp2, Anti-Interleukin-1 receptor-like 2 precursor, Anti-Interleukin-1 receptor-related protein 2, Anti-IL1R-rp2
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunohistochemistry: 1:20-1:50
면역원 서열
QAILTHSGKQYEVLNGITVSITERAGYGGSVPKIIYPKNHSIEVQLGTTLIVDCNVTDTKDNTNLRCWRVNNTLVDDYYDESKRIREGVETHVSFREHNLYTVNITFLEVKMEDYGLPFMCHAG
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... IL1RL2(8808)
IL1RL2 (interleukin 1 receptor-like 2) forms a component of the IL-36 signaling complex, which also includes one of the three IL36 isoforms namely, IL36α, -β or -γ, and is a member of the IL-1 receptor family. Within human myelomonocytic lineage, it is exclusively expressed on dendritic cells (DCs). This gene is localized to human chromosome 2q12. It is composed of three immunoglobulin (Ig)-like domains, which make up the ligand-binding region. It spans the plasma membrane once, and contains a cytosolic region made of 29 amino acids.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|