Merck Anti-PDE5A antibody produced in rabbit
다른 상품 둘러보기
Anti-PDE5A antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-CGB-PDE antibody produced in rabbit, Anti-cGMP-specific 3′,5′-cyclic phosphodiesterase antibody produced in rabbit, Anti-cGMP-binding cGMP-specific phosphodiesterase antibody produced in rabbit
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunohistochemistry: 1:20- 1:50
면역원 서열
GKKNKVIGVCQLVNKMEENTGKVKPFNRNDEQFLEAFVIFCGLGIQNTQMYEAVERAMAKQMVTLEVLSYHASAAEEETRELQSLAAAVVPSAQTLKITDFSFSDFELSDLETALCTIRMFTDLNLVQNFQMKHEVLCRWIL
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... PDE5A(8654)
Cyclic guanosine monophosphate (cGMP)-specific 3′, 5′-cyclic phosphodiesterase (PDE5A) is an 875-amino acid protein. It is expressed in platelets and smooth muscle cells. PDE5A is a homodimer with two regulatory domains that is, a carboxyl-terminal catalytic domain and an amino-terminal domain containing two allosteric cGMP-binding sites. The gene encoding this protein is present on chromosome 4q25-27.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|