상품 옵션 정보 | ||||||||
---|---|---|---|---|---|---|---|---|
카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
HPA018813-100UL | - | Merck HPA018813-100UL Anti-SLC43A1 antibody produced in rabbit, 100uL pk | 재고문의 | pk | 868,530원 | - | 955,383원 |
Anti-SLC43A1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-Solute carrier family 43 member 1, Anti-Large neutral amino acids transporter small subunit 3, Anti-Prostate cancer overexpressed gene 1 protein, Anti-L-type amino acid transporter 3
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200
면역원 서열
MDWRIKDCVDAPTQGTVLGDARDGVATKSIRPRYCKIQ
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... SLC43A1(8501)
The gene solute carrier family 43 member-1 (SLC43A1) is mapped to human chromosome 11p11.1-p11.2. It belongs to the SLC43 family. SLC43A1 transcripts are present in pancreas, liver, skeletal muscle, fetal liver, heart, placenta, lung, kidney, spleen, prostate, testis, ovary, small intestine, colon, lymph node and bone marrow. SLC43A1 is popularly called as LAT3 (L-type amino acid transporter 3).
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.