Anti-PTP4A1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-Protein- tyrosine phosphatase 4a1, Anti-Protein tyrosine phosphatase type IVA 1, Anti-PTP(CAAXI), Anti-Protein-tyrosine phosphatase of regenerating liver 1, Anti-PRL-1
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunohistochemistry: 1:200- 1:500
면역원 서열
HNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKM
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... PTP4A1(7803)
PTP4A1 (Protein tyrosine phosphatase type IVA 1) gene encodes a multifunctional protein belonging to the family of protein-tyrosine phosphatases (PTPs). It is composed of a shallow active-site pocket attached sulfate ion with highly hydrophobic property. It is localized to the endoplasmic reticulum in a farnesylation-dependent manner.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.