Merck Anti-NAXD antibody produced in rabbit
다른 상품 둘러보기
Anti-NAXD antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-CARKD, Anti-FLJ10769, Anti-LP3298, Anti-YM014_HUMAN Isoform 2 of Q8IW45 - Homo sapiens (human), Anti-RP11-90L1.3 antibody produced in rabbit
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunohistochemistry: 1:200- 1:500
면역원 서열
PNAVHEVEKWLPRLHALVVGPGLGRDDALLRNVQGILEVSKARDIPVVIDADGLWLVAQQPALIHGYRKAVLTPNHVEFSRLYDAVLRGPMDSDDSHGSVLRLSQALGNVTVVQ
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... CARKD(55739)
CARKD (carbohydrate kinase domain containing) is one of the initially defined proofreading enzymes involved in intermediary metabolism. It is localized to nucleus, mitochondria and cytosol. It is an ATP-dependent epimerase and dehydratase. CARKD gene encodes which contain a mitochondrial propeptide (mCARKD), a leader peptide (spCARKD), and one which contains neither (cCARKD). spCARKD is N-glycosylated.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|