Merck Anti-ENTPD7 antibody produced in rabbit
상품 옵션 정보 | |||||||||
---|---|---|---|---|---|---|---|---|---|
카탈로그 번호 | CAS 번호 | 설명 | 상태 | 재고 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
HPA014351-100UL | - | Merck HPA014351-100UL Anti-ENTPD7 antibody produced in rabbit, 100uL pk | 재고문의 | 0 | pk | 895,700원 | - | 985,270원 |
다른 상품 둘러보기
Anti-ENTPD7 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-Lysosomal apyrase-like protein 1, Anti-Ectonucleoside triphosphate diphosphohydrolase 7, Anti-NTPDase 7
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunohistochemistry: 1:20- 1:50
면역원 서열
YEDLVLNETLNKNRLLGQKTGLSPDNPFLDPCLPVGLTDVVERNSQVLHVRGRGDWVSCGAMLSPLLARSNTSQASLNGIYQSPIDFNNSEF
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... ENTPD7(57089)
The gene ENTPD7 (ectonucleoside triphosphate diphosphohydrolase 7), also referred to as LALP1 (lysosomal apyrase-like protein), encodes a 604-amino acid protein in human, and is 88% similar to the protein encoded by mouse. The 46kb gene containing 12 exons interspaced by 11 introns is mapped to human chromosome 10q23–q24. It is most abundantly expressed in the brain, kidney, liver, and testis. It is expressed to some extent in the lung, thymus, and heart with lowest expression in the spleen.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|