Merck Anti-ENTPD7 antibody produced in rabbit
토끼에서 생산된 Anti-ENTPD7 항체로, 인간 ENTPD7 단백질을 특이적으로 인식하는 polyclonal 항체입니다. Atlas Antibodies 기술 기반 Prestige Antibodies® 제품으로, 면역조직화학(IHC)에 적합하며 −20°C에서 보관합니다.
- 브랜드
- Merck Sigma
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Merck Sigma · Merck Anti-ENTPD7 antibody produced in rabbit
Anti-ENTPD7 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
Synonyms
- Anti-Lysosomal apyrase-like protein 1
- Anti-Ectonucleoside triphosphate diphosphohydrolase 7
- Anti-NTPDase 7
제품 사양
| 항목 | 내용 |
|---|---|
| Biological source | Rabbit |
| Quality Level | 100 |
| Conjugation | Unconjugated |
| Antibody form | Affinity isolated antibody |
| Antibody type | Primary antibody |
| Clone | Polyclonal |
| Product line | Prestige Antibodies® Powered by Atlas Antibodies |
| Form | Buffered aqueous glycerol solution |
| Species reactivity | Human |
| Packaging | 25 μL (small pack) |
| Technique(s) | Immunohistochemistry (1:20–1:50) |
| Immunogen sequence | YEDLVLNETLNKNRLLGQKTGLSPDNPFLDPCLPVGLTDVVERNSQVLHVRGRGDWVSCGAMLSPLLARSNTSQASLNGIYQSPIDFNNSEF |
| UniProt accession no. | Q9NQZ7 |
| Shipping conditions | Wet ice |
| Storage temperature | −20°C |
Gene Information
Gene: ENTPD7 (ectonucleoside triphosphate diphosphohydrolase 7)
Synonym: LALP1 (lysosomal apyrase-like protein)
Gene ID: ENTPD7 (57089)
Chromosomal location: Human chromosome 10q23–q24
The ENTPD7 gene encodes a 604-amino acid protein in humans, showing 88% similarity to the mouse ortholog. The gene spans approximately 46 kb, containing 12 exons and 11 introns. It is most abundantly expressed in the brain, kidney, liver, and testis, with moderate expression in the lung, thymus, and heart, and lowest expression in the spleen.
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.