Merck Anti-CDS2 antibody produced in rabbit
다른 상품 둘러보기
Anti-CDS2 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-CTP:phosphatidate cytidylyltransferase 2, Anti-Phosphatidate cytidylyltransferase 2, Anti-CDP-DG synthetase 2, Anti-CDP-diacylglycerol synthase 2, Anti-CDP-diglyceride pyrophosphorylase 2, Anti-CDP-diglyceride synthetase 2, Anti-CDP-DAG synthase 2, Anti-CDS 2
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:20-1:50
면역원 서열
MTELRQRVAHEPVAPPEDKESESEAKVDGETASDSESRAESAPLPVSADDTPEVLNRALSNLSSRWK
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... CDS2(8760)
CDS2 (CDP-diacylglycerol synthase 2) is a CDS (CDP-diacylglycerol synthase) encoded protein located to human chromosomes 20p13. It is expressed in the differentiating neuroblasts of neural retina and in the central nervous system during embryonic development. Human CDS2 gene has homology with the Drosophila CDS gene.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.