Merck Anti-ST3GAL2 antibody produced in rabbit
다른 상품 둘러보기
Anti-ST3GAL2 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-SIAT4-B, Anti-Alpha 2,3-ST, Anti-Gal-NAc6S, Anti-CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase, Anti-ST3Gal II, Anti-ST3GalA2, Anti-Beta-galactoside alpha-2,3-sialyltransferase, Anti-Gal-beta-1,3-GalNAc-alpha-2,3-sialyltransferase
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunohistochemistry: 1:50- 1:200
면역원 서열
ATLPYLDSGALDGTHRVKLVPGYAGLQRLSKERLSGKSCACRRCMGDAGASDWFDSHFDGNISPVWTRENMDLPPDVQRWWMMLQPQFKSHNTNEVLEKLFQIVPGENPYRFRDPHQCRRCAVVGNSGNLRGSGYGQDVD
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... ST3GAL2(6483)
ST3GAL2 (ST3 β-galactoside α-2,3-sialyltransferase 2) is a type II transmembrane protein consisting of two putative N-glycosylation sites (Asn(92) and Asn(211)). It is localized along the proximal compartments of the Golgi complex. It exerts enzymatic activity. It shows tissue-specific expression majorly in the skeletal muscle and heart. It is also expressed in the lung and kidney at a very low level.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|