Anti-DNAJC14 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-DnaJ protein homolog 3, Anti-HDJ-3, Anti-DnaJ homolog subfamily C member 14, Anti-Dopamine receptor-interacting protein of 78 kDa, Anti-DRiP78
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human, mouse, rat
포장
antibody small pack of 25 μL
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:200-1:500
면역원 서열
WGWLELPWVKQNINRQGNAPVASGRYCQPEEEVARLLTMAGVPEDELNPFHVLGVEATASDVELKKAYRQLAVMVHPDKNHHPRAEEAFKVLRAAWDIVSNAEKRKEYEMKRMAENELSRSVNEFLSKLQDDLKEAMNTMMCSRCQG
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... DNAJC14(85406)
DNAJC14 (DnaJ heat shock protein family (Hsp40) member C14) belongs to Hsp40 chaperone family. The protein contains 70-amino acid motif called J-domain and a C- terminal domain. J-domain facilitates ATP hydrolysis during chaperoning process. The gene coding for DNAJC14 protein is mapped to human chromosome 12q13.2.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|