AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-P3H2 antibody produced in rabbit
상품 한눈에 보기
토끼에서 생산된 Anti-P3H2 항체로 인간 LEPREL1 단백질을 인식합니다. Prestige Antibodies® 제품으로 높은 특이성과 재현성을 제공합니다. 면역조직화학에 적합하며, −20°C에서 보관합니다. 비접합 폴리클로날 항체 형태입니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-P3H2 antibody produced in rabbit
Anti-P3H2 antibody produced in rabbit
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
Also known as Anti-FLJ10718, Anti-LEPREL1, Anti-MLAT4
제품 스펙
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| Quality Level | 100 |
| 결합 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| 항체 유형 | Primary antibodies |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 형태 | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| 포장 | Small pack of 25 μL |
| 적용 기술 | Immunohistochemistry (1:50–1:200) |
| 면역원 서열 | ANPEHMEMQQNIENYRATAGVEALQLVDREAKPHMESYNAGVKHYEADDFEMAIRHFEQALREYFVEDTECRTLCEGPQRFEEYEYLGYKAGLYEAIADHYMQVLVCQHECV |
| 배송 상태 | Wet ice |
| 저장 온도 | −20°C |
Gene Information
Human [LEPREL1 (55214)]
LEPREL1 (leprecan-like 1) gene, also called P3H2 (prolyl 3-hydroxylase 2), encodes an enzyme belonging to the prolyl 3-hydroxylase family.
It is expressed in placenta, lung, heart, and kidney.
The encoded protein has a molar mass of 80 kDa, consisting of 708 amino acids, and is expressed as a 3.4 kb transcript.
Protein domains include:
- Signal sequence
- Four tetratricopeptide repeats (TPRs)
- Leucine zipper
- P-loop
- Prolyl 4-hydroxylase α domain (P4Hα)
- C-terminal KDEL ER-retention motif
Localization: Endoplasmic reticulum (ER) and Golgi network
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.