Merck Anti-P3H2 antibody produced in rabbit
다른 상품 둘러보기
Anti-P3H2 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-FLJ10718, Anti-LEPREL1, Anti-MLAT4
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunohistochemistry: 1:50- 1:200
면역원 서열
ANPEHMEMQQNIENYRATAGVEALQLVDREAKPHMESYNAGVKHYEADDFEMAIRHFEQALREYFVEDTECRTLCEGPQRFEEYEYLGYKAGLYEAIADHYMQVLVCQHECV
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... LEPREL1(55214)
LEPREL1 (leprecan-like 1) gene is also called P3H2 (prolyl 3-hydroxylase 2) and encodes an enzyme that belongs to the prolyl 3-hydroxylase family. It is expressed in placenta, lung, heart, and kidney. The encoded protein has a molar mass of 80kDa with 708 amino acids and is expressed as a 3.4kb transcript. The protein contains a signal sequence, four tetratricopeptide repeats (TPRs), a leucine zipper, a P-loop, a prolyl 4-hydroxylase α domain (P4Hα), and a C-terminal KDEL ER-retention motif. It is localized to the ER and Golgi network.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|