CacheBy
Merck Anti-P3H2 antibody produced in rabbit
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Merck Anti-P3H2 antibody produced in rabbit

상품 한눈에 보기

토끼에서 생산된 Anti-P3H2 항체로 인간 LEPREL1 단백질을 인식합니다. Prestige Antibodies® 제품으로 높은 특이성과 재현성을 제공합니다. 면역조직화학에 적합하며, −20°C에서 보관합니다. 비접합 폴리클로날 항체 형태입니다.

브랜드
Merck Sigma

Merck Sigma · Merck Anti-P3H2 antibody produced in rabbit

Anti-P3H2 antibody produced in rabbit

제품 개요

Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
Also known as Anti-FLJ10718, Anti-LEPREL1, Anti-MLAT4


제품 스펙

항목 내용
생물학적 소스 Rabbit
Quality Level 100
결합 Unconjugated
항체 형태 Affinity isolated antibody
항체 유형 Primary antibodies
클론 Polyclonal
제품 라인 Prestige Antibodies® Powered by Atlas Antibodies
형태 Buffered aqueous glycerol solution
Species Reactivity Human
포장 Small pack of 25 μL
적용 기술 Immunohistochemistry (1:50–1:200)
면역원 서열 ANPEHMEMQQNIENYRATAGVEALQLVDREAKPHMESYNAGVKHYEADDFEMAIRHFEQALREYFVEDTECRTLCEGPQRFEEYEYLGYKAGLYEAIADHYMQVLVCQHECV
배송 상태 Wet ice
저장 온도 −20°C

Gene Information

Human [LEPREL1 (55214)]

LEPREL1 (leprecan-like 1) gene, also called P3H2 (prolyl 3-hydroxylase 2), encodes an enzyme belonging to the prolyl 3-hydroxylase family.
It is expressed in placenta, lung, heart, and kidney.
The encoded protein has a molar mass of 80 kDa, consisting of 708 amino acids, and is expressed as a 3.4 kb transcript.
Protein domains include:

  • Signal sequence
  • Four tetratricopeptide repeats (TPRs)
  • Leucine zipper
  • P-loop
  • Prolyl 4-hydroxylase α domain (P4Hα)
  • C-terminal KDEL ER-retention motif

Localization: Endoplasmic reticulum (ER) and Golgi network

Merck Sigma 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.