Merck Anti-HSPA13 antibody produced in rabbit
다른 상품 둘러보기
Anti-HSPA13 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-Stress 70 protein chaperone microsome-associated 60 kDa protein precursor, Anti-STCH antibody produced in rabbit, Anti-Microsomal stress 70 protein ATPase core
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunohistochemistry: 1:20-1:50
면역원 서열
AYGLHKADVFHVLVIDLGGGTLDVSLLNKQGGMFLTRAMSGNNKLGGQDFNQRLLQYLYKQIYQTYGFVPSRKEEIHRLRQAVEMVKLNLTLHQSAQLSVLLTVEEQDRKEPHSSDTELPKDKLSSADDH
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... HSPA13(6782)
HSPA13 (heat shock protein 70kDa family, member 13) belongs to the heat shock protein 70 chaperone family. It has a highly conserved N-terminal domain, which contains the ATPase domain, and a unique hydrophobic leader sequence. It is a constitutively and ubiquitously expressed gene, and the encoded protein has a molecular weight of 60kDa. This gene is localized to human chromosome 21q11.1. It is localized to the microsomal region of the cell.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|