상품 옵션 정보 | ||||||||
---|---|---|---|---|---|---|---|---|
카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
HPA008716-100UL | - | Merck HPA008716-100UL Anti-RNF14 antibody produced in rabbit, 100uL pk | 재고문의 | pk | 948,780원 | - | 1,043,658원 |
Anti-RNF14 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-HFB30, Anti-RING finger protein 14, Anti-Triad2 protein, Anti-Androgen receptor-associated protein 54, Anti-E3 ubiquitin-protein ligase RNF14
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
mouse, rat, human
포장
antibody small pack of 25 μL
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:20-1:50
면역원 서열
GCTMGICSSCNFAFCTLCRLTYHGVSPCKVTAEKLMDLRNEYLQADEANKRLLDQRYGKRVIQKALEEMESKEWLEKNSKSCPCCGTPIEKLDGCNKMTCTGCMQYFCWICMGSLSRANPYKHFNDPGSPCFNRLFYAVDVDDDIWEDEV
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... RNF14(9604)
RNF14 (ring finger protein 14) is a ligand-dependent androgen receptor (AR)-associated protein and is also called ARA54. It has a molecular weight of 54kDa and is composed of 474 amino acids. Its middle portion contains RING finger or zinc finger motif, which is rich in cysteine. Downstream to the RING finger motif, it contains another cysteine-rich region similar to B-box. This protein might be the representative of a new subgroup of the B-box RING finger protein family. Its mRNA has the highest expression in testis, followed by thymus, spleen, colon, prostate, uterus, small intestine, and leukocytes of blood. This gene is localized to human chromosome 5q23.3-q31.1.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|