
Merck Anti-RNF14 antibody produced in rabbit
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-RNF14 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-HFB30, Anti-RING finger protein 14, Anti-Triad2 protein, Anti-Androgen receptor-associated protein 54, Anti-E3 ubiquitin-protein ligase RNF14
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
mouse, rat, human
포장
antibody small pack of 25 μL
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:20-1:50
면역원 서열
GCTMGICSSCNFAFCTLCRLTYHGVSPCKVTAEKLMDLRNEYLQADEANKRLLDQRYGKRVIQKALEEMESKEWLEKNSKSCPCCGTPIEKLDGCNKMTCTGCMQYFCWICMGSLSRANPYKHFNDPGSPCFNRLFYAVDVDDDIWEDEV
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... RNF14(9604)
RNF14 (ring finger protein 14) is a ligand-dependent androgen receptor (AR)-associated protein and is also called ARA54. It has a molecular weight of 54kDa and is composed of 474 amino acids. Its middle portion contains RING finger or zinc finger motif, which is rich in cysteine. Downstream to the RING finger motif, it contains another cysteine-rich region similar to B-box. This protein might be the representative of a new subgroup of the B-box RING finger protein family. Its mRNA has the highest expression in testis, followed by thymus, spleen, colon, prostate, uterus, small intestine, and leukocytes of blood. This gene is localized to human chromosome 5q23.3-q31.1.
🏷️Merck Sigma 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Merck Sigma
Merck Anti-SGSM1 antibody produced in rabbit
895,700원

Merck Sigma
Merck Anti-APC antibody produced in rabbit
370,530원

Merck Sigma
Merck Anti-RNF14 antibody produced in rabbit
895,700원

Merck Sigma
Merck Anti-ZNF415 antibody produced in rabbit
895,700원

Merck Sigma
Merck Anti-STXBP2 antibody produced in rabbit
895,700원
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|