
Merck Anti-AGAP2 antibody produced in rabbit
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-AGAP2 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-GGAP2, Anti-AGAP-2, Anti-Arf-GAP, GTPase, ANK repeat and PH domain-containing protein 2, Anti-Phosphatidylinositol-3-kinase enhancer, Anti-Centaurin-gamma-1, Anti-GTP-binding and GTPase-activating protein 2, Anti-PIKE
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200
면역원 서열
PSASINGLVKDMSTVQMGEGLEATTPMPSPSPSPSSLQPPPDQTSKHLLKPDRNLARALSTDCTPSGDLSPLSREPPPSPMVKKQRRKKLTTPSKTE
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... AGAP2(116986)
The gene AGAP2 (ArfGAP with GTPase domain, ankyrin repeat and PH domain 2) belongs to the group of proteins called AZAPs that contain a catalytic core of PH (pleckstrin homology), Arf GAP and two or more ankyrin repeat domains. The AZAP family is further divided into four subfamilies, of which AGAPs contain an NH2-terminal GTPase-like domain (GLD), a split PH domain, and the GAP domain followed by four ankyrin repeats. Agap2 is found to be overexpressed in various human cancers.
🏷️Merck Sigma 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Merck Sigma
Merck Anti-ZNF366 antibody produced in rabbit
895,600원

Merck Sigma
Merck Anti-TDRKH antibody produced in rabbit
895,600원

Merck Sigma
Merck Anti-AGAP2 antibody produced in rabbit
895,600원

Merck Sigma
Merck Anti-TRIM5 antibody produced in rabbit
370,530원

Merck Sigma
Merck Anti-CCDC182 antibody produced in rabbit
895,700원
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|