
Merck Anti-ASPSCR1 antibody produced in rabbit
Merck의 Anti-ASPSCR1 rabbit polyclonal antibody는 인간 ASPSCR1 단백질을 특이적으로 인식하는 1차 항체로, Prestige Antibodies® 라인 제품입니다. 면역블롯, 면역형광, 면역조직화학에 적합하며, −20°C에서 보관합니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-ASPSCR1 antibody produced in rabbit
Anti-ASPSCR1 antibody produced in rabbit
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution.
Anti-Alveolar soft part sarcoma chromosomal region candidate gene 1 protein, Anti-Alveolar soft part sarcoma locus, Anti-UBX domain-containing protein 9, Anti-Tether containing UBX domain for GLUT4, Anti-Renal papillary cell carcinoma protein 17.
생물학적 소스
rabbit
Quality Level
100
결합
unconjugated
항체 형태
affinity isolated antibody
항체 유형
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
형태
buffered aqueous glycerol solution
반응 종
human
포장
antibody small pack of 25 μL
실험 적용
| Technique | Working Concentration |
|---|---|
| Immunoblotting | 0.04–0.4 μg/mL |
| Immunofluorescence | 0.25–2 μg/mL |
| Immunohistochemistry | 1:200–1:500 |
면역원 서열
GSSASAGQAAASAPLPLESGELSRGDLSRPEDADTSGPCCEHTQEKQSTRAPAAAPFVPFSGGGQRLGGPPGPTRPLTSSS
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ASPSCR1(79058)
Alveolar soft part sarcoma chromosomal region candidate 1 (ASPSCR1) gene is mapped to human chromosome 17q25.
ASPSCR1, also known as alveolar soft part sarcoma locus (ASPL) or TUG (tether, containing a UBX domain, for GLUT4), codes for a member of UBX-domain containing proteins.
The encoded protein consists of 553 amino acids and features a C-terminal ubiquitin regulatory X (UBX)-like domain.
ASPSCR1 is ubiquitously expressed in all adult tissues.
Merck Sigma 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



