다른 상품 둘러보기
Anti-ASPSCR1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-Alveolar soft part sarcoma chromosomal region candidate gene 1 protein, Anti-Alveolar soft part sarcoma locus, Anti-UBX domain-containing protein 9, Anti-Tether containing UBX domain for GLUT4, Anti-Renal papillary cell carcinoma protein 17
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500
면역원 서열
GSSASAGQAAASAPLPLESGELSRGDLSRPEDADTSGPCCEHTQEKQSTRAPAAAPFVPFSGGGQRLGGPPGPTRPLTSSS
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... ASPSCR1(79058)
Alveolar soft part sarcoma chromosomal region candidate 1 (ASPSCR1) gene is mapped to human chromosome 17q25. ASPSCR1, also known as alveolar soft part sarcoma locus (ASPL) or TUG (tether, containing a UBX domain, for GLUT4) codes for a member of UBX – domain containing proteins. The encoded protein consist of 553 amino acids and it is characterized with a C-terminal ubiquitin regulatory X (UBX)-like domain. ASPSCR1 is ubiquitously expressed in all adult tissues.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|