Merck Anti-ASMTL antibody produced in rabbit
다른 상품 둘러보기
Anti-ASMTL antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-ASMTL, Anti-N-acetylserotonin O-methyltransferase-like protein
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500
면역원 서열
RLLDICAAMGLLEKTEQGYSNTETANVYLASDGEYSLHGFIMHNNDLTWNLFTYLEFAIREGTNQHHRALGKKAEDLFQDAYYQSPETRLRFMRAMHGMTKLTACQVATAFNLSRFSSACDVGGCTGALARELAREYPRMQVTV
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... ASMTL(8623)
ASMTL (Acetylserotonin O-methyltransferase-like) is a novel gene located in the pseudoautosomal region (PAR1) of the human X and Y chromosomes. It has a bipartite structure expressed in pancreas, placenta, colon, fibroblast and fetal brain tissues. Its C-terminal end possesses structural homology with N-acetylserotonin O-methyltransferase and N-terminal end has the similarity with multicopy associated filamentation (maf) protein of Bacillus subtilis and to orfE of Escherichia coli. ASMTL encodes the enzyme catalysing the last step in the synthesis of melatonin.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|