Merck Anti-PCMTD1 antibody produced in rabbit
다른 상품 둘러보기
Anti-PCMTD1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-Protein-L-isoaspartate O-methyltransferase domain-containing protein 1
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:500-1:1000
면역원 서열
FVGNQLIPQPLDSEEDEKMEEDNKEEEEKDHNEAMKPEEPPQNLLREKIMKLPLPE
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... PCMTD1(115294)
The gene PCMTD1 (protein-L-isoaspartate (D-aspartate) O-methyltransferase domain containing 1) is mapped to human chromosome 8q. Single nucleotide polymorphism at rs1015213, which is present in the intergenic region between PCMTD1 and ST18 (suppression of tumorigenicity 18), is associated with primary angle closure glaucoma. However, it is not responsible for any phenotypic diversity in the disease severity or progression.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|