Merck Anti-FAT1 antibody produced in rabbit
다른 상품 둘러보기
Anti-FAT1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-Protein fat homolog, Anti-Cadherin-related tumor suppressor homolog, Anti-Protocadherin Fat 1
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunohistochemistry: 1:50- 1:200
면역원 서열
NFQRALRNILGVRRNDIQIVSLQSSEPHPHLDVLLFVEKPGSAQISTKQLLHKINSSVTDIEEIIGVRILNVFQKLCAGLDCPWKFCDEKVSVDESVMSTHSTARLSFVTPRHHRAAVCLCKEGRCP
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... FAT1(2195)
FAT atypical cadherin 1 (FAT1) protein is encoded by a gene mapped to human chromosome 4q34-35. The protein has ubiquitous expression in mammalian tissues, especially higher in kidney glomerular epithelial cells. FAT1 is localized to the leading edge of lamellipodia, filopodia, and microspike tips of cells. The protein is found to be abnormally expressed in pediatric patients with acute leukemia.
The encoded protein is characterized with cytoplasmic domain that is involved in assembly of components necessary to promote ectopic actin polymerization.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|