Merck Anti-SLC12A2 antibody produced in rabbit
다른 상품 둘러보기
Anti-SLC12A2 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-PPP1R141, Anti-NKCC1, Anti-BSC2, Anti-BSC
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunohistochemistry: 1:500- 1:1000
면역원 서열
TLVLGFKKDWLQADMRDVDMYINLFHDAFDIQYGVVVIRLKEGLDISHLQGQEELLSSQEKSPGTKDVVVSVEYSKKSDLDTSKPLSE
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... SLC12A2(6558)
Solute carrier family 12 member 2 (SLC12A2) is a member of the cation–chloride cotransporters (CCCs) family. The SLC12A2 gene is mapped to human chromosome 5q23.3. It is widely expressed in neurons and also in other organs especially, in the secretory epithelial cells. SLC12A2 exists as eight isoforms. It comprises 12 transmembrane (TM) helices and assembles into a dimer with TM11-TM12 helices lining the dimer interface.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|