Merck Anti-TNK1 antibody produced in rabbit
다른 상품 둘러보기
Anti-TNK1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-Non-receptor tyrosine-protein kinase TNK1, Anti-CD38 negative kinase 1
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunohistochemistry: 1:20- 1:50
면역원 서열
PSEACCVRDVTEPGALRMETGDPITVIEGSPDSTIWKGQNGRTFKVGSFPASAVTLADAGGLPATRPVHRGTPARGDQHPGSIDGDRKKANLWDAPPARGQRRNMPLERMKGISRSLESVLSLG
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... TNK1(8711)
TNK1 (Tyrosine kinase, non-receptor, 1) is a novel 72kDa nonreceptor tyrosine kinase protein beloniging to the ACK (Activated CDC42 kinase) family of non-receptor tyrosine kinases. It consists of an N-terminal kinase domain, a putative Src Homology 3 (SH3) domain at the C-terminal end, and a proline-rich tail. TNK1 is expressed in all fetal tissues such as cord blood, bone marrow and adult tissues such as prostate, testis, ovary, small intestine and colon. In addition to normal tissues, its expression also have been found in the several leukemia cell lines.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|