Anti-HIPK2 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-hHIPk2, Anti-Homeodomain-interacting protein kinase 2
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunohistochemistry: 1:50- 1:200
면역원 서열
QVFSPHTLQSSAFCSVKKLKIEPSSNWDMTGYGSHSKVYSQSKNIPLSQPATTTVSTSLPVPNPSLPYEQTIVFPGSTGHIVVTSASSTSVTGQVLGGPHNLMRRSTVSLLDTYQKCGLKRKSEEIENTSSVQIIEEHPP
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... HIPK2(28996)
HIPK2 (homeodomain interacting protein kinase 2) gene encodes a serine/threonine kinase belonging to the homeodomain-interacting protein kinase family and the sub family of dual-specificity Yak1-related kinase proteins. It functions as a co-repressor for homeodomain transcription factors. It contains an interaction domain for homeoproteins, a corepressor domain (CRD), PEST sequence, and a protein kinase domain along with a YH domain in the C terminus. It is localized to nuclear speckles by means of a speckle-retention signal and is covalently modified by the ubiquitin-like protein SUMO-1.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|