상품 옵션 정보 | |||||||
---|---|---|---|---|---|---|---|
카탈로그 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
HPA006655-100UL | Merck HPA006655-100UL Anti-TSTD1 antibody produced in rabbit, 100uL pk | 재고문의 | pk | 948,780원 | - | 1,043,658원 |
Anti-TSTD1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-KAT, Anti-OR6-8, Anti-dJ80I19.4, Anti-thiosulfate sulfurtransferase (rhodanese)-like domain containing 1, Anti-hs6M1-6
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200
면역원 서열
MAGAPTVSLPELRSLLASGRARLFDVRSREEAAAGTIPGALNIPVSELESALQMEPAAFQALYSAEKPKLEDEHLVFFCQMGKRGLQATQLARSLGYTGYG
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... TSTD1(100131187)
TSTD1 (thiosulfate sulfurtransferase (rhodanese)-like domain containing 1) is a highly conserved protein among mammals with a molecular weight of 12.5kDa. It is expressed in a wide range of human tissues, including kidney, liver, skeletal muscle, heart, colon, thymus, spleen, placenta, and lung, mainly localized around the nuclear membranes. In addition to the normal cells, the expression of TSTD1 also has been reported in the breast, colon, and lung carcinoma cell lines. Studies have been suggested that it may have role in the tumorigenesis.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|