Anti-RANBP17 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, ab1
Anti-TDPX1, Anti-PRP, Anti-MGC4104, Anti-PRX2, Anti-FLJ30135, Anti-NKEFB, Anti-BLOS2, Anti-MGC10120, Anti-PRXII, Anti-TSA, Anti-RAN binding protein 17
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunofluorescence: 0.25-2 μg/mL
면역원 서열
MDGELSCRVFQLISLMDTGLPRCCNEKIELAILWFLDQFRKTYVGDQLQRTSKVYARMSEVLGITDDNHVLETFMT
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... RANBP17(64901)
RANBP17 (Ran-binding protein 17) belongs to the importin-β superfamily. It is identified in both the nuclear and cytosolic fractions. It is located on chromosome 5. It is mostly expressed in the testis. In primary spermatocytes, RANBP17 is confined to the XY body. It interacts with sperm maturation 1 (SPEM1).
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.