Merck Anti-SHANK1 antibody produced in rabbit
토끼에서 생산된 Anti-SHANK1 폴리클로날 항체로, 인간 SHANK1 단백질을 특이적으로 인식합니다. Prestige Antibodies® 라인 제품으로 면역형광, 면역조직화학, 웨스턴 블롯 등에 적합합니다. 친화력 정제된 항체이며 −20°C에서 보관합니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-SHANK1 antibody produced in rabbit
Anti-SHANK1 antibody produced in rabbit
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
관련 항체:
Anti-synamon, Anti-SSTRIP, Anti-SH3 and multiple ankyrin repeat domains 1, Anti-SPANK-1
생물학적 소스
rabbit
품질 등급
100 (M-Clarity Program)
결합 형태
unconjugated
항체 형태
affinity isolated antibody
항체 유형
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
형태
buffered aqueous glycerol solution
반응 종
human
포장
antibody small pack of 25 μL
실험 적용
| 실험 기술 | 사용 농도 |
|---|---|
| Immunofluorescence | 0.25–2 μg/mL |
| Immunohistochemistry | 1:200–1:500 |
| Western blot | 0.04–0.4 μg/mL |
면역원 서열
TVKASIISELSSKLQQFGGSSAAGGALPWARGGSGGGGDSHHGGASYVPERTSSLQRQRLSDDSQSSLLSKPVSSLFQNWPKPPLP
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
유전자 정보
Gene: human SHANK1(50944)
The gene SHANK1 (SH3 and multiple ankyrin repeat domains 1) is mapped to human chromosome 19q13.33.
It belongs to the Shank family of genes. The encoded protein is mainly present in the dendrites of hippocampal neurons and cerebellar Purkinje cells.
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.