상품 옵션 정보 | ||||||||
---|---|---|---|---|---|---|---|---|
카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
HPA031470-100UL | - | Merck HPA031470-100UL Anti-ABCG1 antibody produced in rabbit, 100uL pk | 재고문의 | pk | 868,530원 | - | 955,383원 |
Anti-ABCG1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, ab1
Anti-ATP-binding cassette, sub-family G (WHITE), member 1, Anti-ABC8
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunofluorescence: 0.25-2 μg/mL
면역원 서열
AEMTEPKSVCVSVDEVVSSNMEATETDLLNGHLKKVDNNLTEAQRFSSLPRRAAVNIEFRDLSYSVPEG
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... ABCG1(9619)
ABCG1 (ATP-binding cassette G1) gene is mapped to human chromosome 21q22.3. The encoded protein belongs to the G subfamily of ATP binding cassette (ABC) transporters. ABCG1 is expressed highly in neurons and glia in the central nervous system, brain, spleen and lungs. In mammals, most of the ABC transporters are present in the plasma membrane and are involved in the passage of substances from the inside of the cell to the outside space. Various ABC transporters are known to localize and function in intracellular compartments.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|