Merck Anti-ARHGAP32 antibody produced in rabbit
다른 상품 둘러보기
Anti-ARHGAP32 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-GRIT, Anti-Rho GTPase activating protein 32, Anti-MGC1892, Anti-GC-GAP, Anti-RICS, Anti-KIAA0712
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200
면역원 서열
ERDPSVLYQYQPHGKRQSSVTVVSQYDNLEDYHSLPQHQRGVFGGGGMGTYVPPGFPHPQSRTYATALGQGAFLPAELSLQHPETQIHAE
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... ARHGAP32(9743)
Rho GTPase activating protein 32 (ARHGAP32) is encoded by the RICS gene mapped to human chromosome 11q24.3. RICS exists in two isoforms; RICS is expressed specifically in the brain in humans, whereas, PX-RICS is expressed in several tissues but at high levels in the brain. PX-RICS is characterized by a N-terminal src homology 3 (SH3) and a phox-homology (PX) domain mainly involved in binding phosphatidylinositol-4-phosphate (PI4P).
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|