Merck Anti-CX3CL1 antibody produced in rabbit
다른 상품 둘러보기
Anti-CX3CL1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-Chemokine (c-x3-c motif) ligand 1, Anti-Neurotactin, Anti-Fractalkine, Anti-C3xkine, Anti-Ntn, Anti-Cxc3c, Anti-Abcd-3, Anti-Cxc3, Anti-Scyd1
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunohistochemistry: 1:500- 1:1000
면역원 서열
GVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNGGTFEKQIGEVKPRTTPAAGGMDESVVLE
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... CX3CL1(6376)
C-X3-C motif chemokine ligand 1(CX3CL1), also known as fractalkine (FKN), is encoded by the gene mapped to human chromosome 16q21. The encoded protein acts as a chemotactic cytokine in a soluble form, or acts as a binding molecule in a membrane-attached form. CX3CL1 is characterized by a mucin-like stalk containing chemokine domain and single transmembrane domain with a short intracellular C-terminal. CX3CL1 belongs to the CX3C chemokine subfamily.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|