Merck Anti-Spire1 antibody produced in rabbit
다른 상품 둘러보기
Anti-Spire1 antibody produced in rabbit
affinity isolated antibody, buffered aqueous glycerol solution
Anti-KIAA1135, Anti-Spire homolog 1 (Drosophila), Anti-Spir-1
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunohistochemistry: 1:50-1:200
면역원 서열
LQRGESSMRSEKPSTAHHRPLRSIARFSSKSKSMDKSDEELQFPKELMEDWSTMEVCVDCKKFISEIISSSRRSLVLANKRARLKRKTQ
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... SPIRE1(56907)
SPIRE1 (spire type actin nucleation factor 1) is a modular protein, that has a cluster of four actin-binding WH2 (wasp-homology 2) domains. It belongs to the SPIRE family of actin nucleators. The N-terminal region (Nt-Spire) comprises of a kinase-like noncatalytic domain (KIND) and the C-terminal moiety has a spir box and a FYVE-related domain. Spire1 is expressed in cerebellum and cerebrum. This gene located on human chromosome 18p.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.