Merck Anti-KLHL36 antibody produced in rabbit
다른 상품 둘러보기
Anti-KLHL36 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-Kelch-like 36 (Drosophila), Anti-FLJ12543, Anti-C16orf44
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500
면역원 서열
EDNYLYLQELASIYSLKRLDAFIDGFILNHFGTLSFTPDFLQNVSMQKLCVYLSSSEVQRECEHDLLQAALQWLTQQPEREAHARQVLENIHFPLIPKNDLLH
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... KLHL36(79786)
The gene KLHL36 (kelch like family member 36) encodes a member of the Kelch-like (KLHL) protein family, the members of which contain a BTB/POZ (Broad-Complex, Tramtrack and Bric a brac/ POxvirus and Zinc finger) domain, a BACK (BTB and C-terminal Kelch) domain, and five to six Kelch motifs. The BTB domain participates in protein association and dimerization. The kelch domains form a tertiary structure of β-propellers that function in several extracellular processes, such as morphology and protein association. The function of the BACK domain is yet to be characterized. However, mutations in this domain are associated with disease. Around 42 KLHL genes have been identified across multiple human chromosomes. The encoded protein is 616 amino acids long.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|