Merck Anti-PNLDC1 antibody produced in rabbit
다른 상품 둘러보기
Anti-PNLDC1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-dJ195P10.2, Anti-FLJ40240, Anti-poly(A)-specific ribonuclease (PARN)-like domain containing 1
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunohistochemistry: 1:200- 1:500
면역원 서열
VGHNMMMDLLHLHEKFFRPLPESYDQFKQNIHSLFPVLIDTKSVTKDIWKEMNFPRVSNLSEVYEVLNSDLNPT
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... PNLDC1(154197)
The gene PNLDC1 (PARN like, ribonuclease domain containing 1) is mapped to human chromosome 6q. It is a homologue of PARN (poly(A)-specific ribonuclease). The protein is present in the cytoplasm of stem and spermatogenic cells. The protein has a putative transmembrane domain. The PNLDC1 protein also contains an RNaseH-like domain and RNAse_CAF1 (CCR4-associated factor 1) domain. PNLDC1 is mainly expressed in the early stages of development and upon differentiation.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|