Merck Anti-BST1 antibody produced in rabbit
다른 상품 둘러보기
Anti-BST1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-bone marrow stromal cell antigen 1, Anti-CD157
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunohistochemistry: 1:50- 1:200
면역원 서열
EGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWE
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... BST1(683)
The gene BST1 (bone marrow stromal cell antigen 1) is mapped to human chromosome 4p15. It belongs to the CD38 (cluster of differentiation 38) gene family and the encoded protein is a member of the NADase (NAD+ glycohydrolase)/ADP (adenosine diphosphate)-ribosyl cyclase family. The BST1 gene encodes a glycosylphosphatidylinositol-anchored protein. It is present in myeloid, endothelial and mesothelial cells as well as in epithelial ovarian cancer cells.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|