Merck Anti-FLVCR1 antibody produced in rabbit
다른 상품 둘러보기
Anti-FLVCR1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-PCA, Anti-MFSD7B, Anti-AXPC1, Anti-FLVCR, Anti-feline leukemia virus subgroup C cellular receptor 1
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200
면역원 서열
KSDLRRHNINIGITNVDVKAIPADSPTDQEPKTVMLSKQSESAI
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... FLVCR1(28982)
The gene FLVCR1 (feline leukemia virus subgroup C cellular receptor 1) is mapped to human chromosome 1q32. The gene encodes two proteins, FLVCR1a (a heme exporter in the plasma membrane) and FLVCR1b (a heme exporter in the mitochondria). FLVCR1a has 12 transmembrane domains and FLVCR1b has six transmembrane domains.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.