Merck Anti-PPP1R11 antibody produced in rabbit
다른 상품 둘러보기
Anti-PPP1R11 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-HCG-V, Anti-HCGV, Anti-protein phosphatase 1, regulatory (inhibitor) subunit 11, Anti-Tctex5, Anti-TCTE5
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunohistochemistry: 1:20- 1:50
면역원 서열
AGLSETVTETTVTVTTEPENRSLTIKLRKRKPEKKVEWTSDTVDNEHMGRRSSKCCCIYEKPRAFG
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... PPP1R11(6992)
PPP1R11 (protein phosphatase 1 regulatory inhibitor subunit 11) is widely expressed and the gene is mapped to human chromosome 17. The encoded protein is mainly localized to the nucleoli and centrosomes. In mitotic cells, it is present with the mitotic apparatus. The PPP1R11 protein has a nuclear localization sequence as well as a nucleolar targeting sequence.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.