Merck Anti-ZNF665 antibody produced in rabbit
다른 상품 둘러보기
Anti-ZNF665 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-FLJ14345, Anti-zinc finger protein 665
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000
면역원 서열
VSLDISCKCVNTDLPPKGKNNMGEAFYTVKLERLESCDTVGLSFQEVQKNTYDFECQWKDD
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... ZNF665(79788)
The gene ZNF665 (zinc finger protein 665) is mapped to human chromosome 19. It is a member of zinc finger protein family that is characterized by the presence of a highly conserved zinc finger motif of 28–30 amino acids and Krüppel-associated boxes or KRAB domain. The zinc finger proteins participate in several cellular processes, including DNA recognition, RNA packaging, transcriptional activation, regulation of apoptosis, protein folding and assembly, and lipid binding.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|