다른 상품 둘러보기
Anti-MARVELD2 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-FLJ30532, Anti-MARVEL domain containing 2, Anti-MRVLDC2, Anti-DFNB49, Anti-TRIC
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunohistochemistry: 1:1000- 1:2500
면역원 서열
AKYPVIQTDDERERYKAVFQDQFSEYKELSAEVQAVLRKFDELDAVMSRLPHHSESRQEHERISRIHEEFKKKKNDPTFLEKKERCDYLKNKLSHIKQRIQEYDKVMNWDV
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... MARVELD2(153562)
MARVEL domain containing 2 (MARVELD2) is a transmembrane protein located at the junction where three epithelial cells meet. It is known as tricellulin or tricellular tight junction protein. It possesses four transmembrane domains and the MAL and related proteins for vesicle trafficking and membrane link (MARVEL) domain. MARVELD2 is expressed in pancreatic ducts.
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제 방법 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.