Merck Anti-CTC-534A2.2 antibody produced in rabbit
토끼에서 생산된 polyclonal 항체로, Human Protein Atlas 프로젝트를 통해 검증된 Prestige Antibodies® 제품입니다. 인간 단백질에 반응하며, 면역형광에 적합합니다. −20°C에서 보관하며, 25 μL 소포장으로 제공됩니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-CTC-534A2.2 antibody produced in rabbit
Anti-CTC-534A2.2 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody
제품 개요
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and are supported by the most extensive characterization in the industry.
The Human Protein Atlas project is divided into three major efforts:
- Human Tissue Atlas
- Cancer Atlas
- Human Cell Atlas
Antibodies generated for the Tissue and Cancer Atlas projects have been tested by immunohistochemistry on hundreds of normal and diseased tissues. Through the Human Cell Atlas project, many have also been validated by immunofluorescence to map the human proteome at both tissue and subcellular levels.
For additional data and images, visit the Human Protein Atlas (HPA) website.
Protocols and further information about Prestige Antibodies are available at sigma.com/prestige.
제품 사양
| 항목 | 내용 |
|---|---|
| Biological source | Rabbit |
| Quality level | 100 |
| Conjugate | Unconjugated |
| Antibody form | Affinity isolated antibody |
| Antibody type | Primary antibodies |
| Clone | Polyclonal |
| Product line | Prestige Antibodies® Powered by Atlas Antibodies |
| Formulation | Buffered aqueous glycerol solution |
| Species reactivity | Human |
| Packaging | Antibody small pack of 25 μL |
| Application (technique) | Immunofluorescence: 0.25–2 μg/mL |
| Immunogen sequence | TEVILHYRPCESDPTQLPKIAEKAIQDFPTRPLSRFIPWFPYDGSKLPLRPKRSPPVISEEAAEDVKQYLTISEH |
| Shipping condition | Wet ice |
| Storage temperature | −20 °C |
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.