Merck Anti-CTC-534A2.2 antibody produced in rabbit
토끼에서 생산된 polyclonal 항체로, Human Protein Atlas 프로젝트를 통해 검증된 Prestige Antibodies® 제품입니다. 인간 단백질에 반응하며, 면역형광에 적합합니다. −20°C에서 보관하며, 25 μL 소포장으로 제공됩니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CTC-534A2.2 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody
제품 개요
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and are supported by the most extensive characterization in the industry.
The Human Protein Atlas project is divided into three major efforts:
- Human Tissue Atlas
- Cancer Atlas
- Human Cell Atlas
Antibodies generated for the Tissue and Cancer Atlas projects have been tested by immunohistochemistry on hundreds of normal and diseased tissues. Through the Human Cell Atlas project, many have also been validated by immunofluorescence to map the human proteome at both tissue and subcellular levels.
For additional data and images, visit the Human Protein Atlas (HPA) website.
Protocols and further information about Prestige Antibodies are available at sigma.com/prestige.
제품 사양
| 항목 | 내용 |
|---|---|
| Biological source | Rabbit |
| Quality level | 100 |
| Conjugate | Unconjugated |
| Antibody form | Affinity isolated antibody |
| Antibody type | Primary antibodies |
| Clone | Polyclonal |
| Product line | Prestige Antibodies® Powered by Atlas Antibodies |
| Formulation | Buffered aqueous glycerol solution |
| Species reactivity | Human |
| Packaging | Antibody small pack of 25 μL |
| Application (technique) | Immunofluorescence: 0.25–2 μg/mL |
| Immunogen sequence | TEVILHYRPCESDPTQLPKIAEKAIQDFPTRPLSRFIPWFPYDGSKLPLRPKRSPPVISEEAAEDVKQYLTISEH |
| Shipping condition | Wet ice |
| Storage temperature | −20 °C |
🏷️Merck Sigma 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Merck Sigma
Merck Anti-COX15 antibody produced in rabbit
370,530원
Merck Sigma
Merck Anti-LARS2 antibody produced in rabbit
370,530원
Merck Sigma
Merck Anti-CTC-534A2.2 antibody produced in rabbit
370,530원
Merck Sigma
Merck Anti-ABHD10 antibody produced in rabbit
370,530원
Merck Sigma
Merck Anti-PP2D1 antibody produced in rabbit
370,530원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|