상품 옵션 정보 | ||||||||
---|---|---|---|---|---|---|---|---|
카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
HPA010948-100UL | - | Merck HPA010948-100UL Anti-DPYSL3 antibody produced in rabbit, 100uL pk | 재고문의 | pk | 948,780원 | - | 1,043,658원 |
Anti-DPYSL3 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-DRP-3, Anti-Collapsin response mediator protein 4, Anti-CRMP-4, Anti-ULIP protein, Anti-Dihydropyrimidinase-related protein 3, Anti-Unc-33-like phosphoprotein
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human, rat, mouse
포장
antibody small pack of 25 μL
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:1000-1:2500
면역원 서열
IIDHVVPEPESSLTEAYEKWREWADGKSCCDYALHVDITHWNDSVKQEVQNLIKDKGVNSFMVYMAYKDLYQVSNTELYEIFTCLGELGAIAQVHAENGDIIAQEQTRMLEMGITGPE
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... DPYSL3(1809)
DPYSL3 (dihydropyrimidinase-like 3) belongs to collapsin response mediator proteins (CRMPs) family, which are phosphoproteins that reside in the cytoplasm. In humans, this family consists of five members. DPYSL3 has two isoforms due to alternate splicing. The long isoform consists of an extra domain in the N-terminal, the function and structure of which is not known. This family of proteins is highly expressed in the nervous system during developmental stages. This gene is localized to human chromosome 5q32. DPYSL3 is not found in adult brain, but is expressed in brain and spinal cord of fetus.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|