
Merck Anti-DPYSL3 antibody produced in rabbit
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-DPYSL3 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-DRP-3, Anti-Collapsin response mediator protein 4, Anti-CRMP-4, Anti-ULIP protein, Anti-Dihydropyrimidinase-related protein 3, Anti-Unc-33-like phosphoprotein
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human, rat, mouse
포장
antibody small pack of 25 μL
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:1000-1:2500
면역원 서열
IIDHVVPEPESSLTEAYEKWREWADGKSCCDYALHVDITHWNDSVKQEVQNLIKDKGVNSFMVYMAYKDLYQVSNTELYEIFTCLGELGAIAQVHAENGDIIAQEQTRMLEMGITGPE
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... DPYSL3(1809)
DPYSL3 (dihydropyrimidinase-like 3) belongs to collapsin response mediator proteins (CRMPs) family, which are phosphoproteins that reside in the cytoplasm. In humans, this family consists of five members. DPYSL3 has two isoforms due to alternate splicing. The long isoform consists of an extra domain in the N-terminal, the function and structure of which is not known. This family of proteins is highly expressed in the nervous system during developmental stages. This gene is localized to human chromosome 5q32. DPYSL3 is not found in adult brain, but is expressed in brain and spinal cord of fetus.
🏷️Merck Sigma 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Merck Sigma
Merck Anti-RBMX2 antibody produced in rabbit
370,530원

Merck Sigma
Merck Anti-ZYG11B antibody produced in rabbit
895,700원

Merck Sigma
Merck Anti-DPYSL3 antibody produced in rabbit
895,700원

Merck Sigma
Merck Anti-KIF13A antibody produced in rabbit
895,700원

Merck Sigma
Merck Anti-RBL2 antibody produced in rabbit
817,800원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
