Merck Anti-LRIG3 antibody produced in rabbit
다른 상품 둘러보기
Anti-LRIG3 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-LIG-3, Anti-Leucine-rich repeats and immunoglobulin-like domains protein 3 precursor
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000
면역원 서열
NLCLNKSSLDFSANPEPASVASSNSFMGTFGKALRRPHLDAYSSFGQPSDCQPRAFYLKAHSSPDLDSGSEEDGKERTDFQEENHICTFKQTLENYRTPN
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... LRIG3(121227)
LRIG3 (leucine-rich repeats and immunoglobulin-like domains 3) belongs to a family of integral plasma membrane proteins called LRIG. It is a transmembrane glycol-protein, which consists of an extracellular domain of leucine-rich repeats, three immunoglobulin-like domains and an intracellular region. The gene to this protein is located on human chromosome 12q13.2. LRIG3 mRNA is predominantly expressed in thyroid, skin and stomach, and is least expressed in heart and blood.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제수단 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|